Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDC1 Peptide - N-terminal region

YTHDC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1966, YT521, YT521-B

UniProt

Q96MU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YTHDC1 Rabbit Polyclonal Antibody (orb326571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_588611

Preservative

Lyophilized powder

AA Sequence

GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-mouse CD206 (MMR) Recombinant
GT06182 100 µg

Purified anti-mouse CD206 (MMR) Recombinant

Sign In for Pricing
View Details
Bovine PP ELISA Kit
EBP0141 96 Tests

Bovine PP ELISA Kit

Sign In for Pricing
View Details
Clec14a sgRNA CRISPR Lentivector (Rat) (Target 2)
K6686303 1.0 µg DNA

Clec14a sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SLC5A4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV659609 1.0 µg DNA

SLC5A4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
DPP8 ELISA Kit (Human) (OKCD00924)
OKCD00924 96 Well

DPP8 ELISA Kit (Human) (OKCD00924)

Sign In for Pricing
View Details
Cortactin antibody
70R-2725 50 ug

Cortactin antibody

Sign In for Pricing
View Details