Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36AL Peptide - C-terminal region

RPL36AL Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111574, RPL36A

UniProt

Q969Q0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL36AL Rabbit Polyclonal Antibody (orb586422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000992

Preservative

Lyophilized powder

AA Sequence

FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pcdhga1 qPCR Primer Pair
QM47506S 200 Tests

Mouse Pcdhga1 qPCR Primer Pair

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1016) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-5321R-BF750 100 µL

Phospho-EGFR (Tyr1016) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant human TRANCE/RANK L/TNFSF11 protein
ATGP4157-050 50 µg

Recombinant human TRANCE/RANK L/TNFSF11 protein

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-01 48 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-02 96 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-03 5x 96 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details