Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36AL Peptide - C-terminal region

RPL36AL Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111574, RPL36A

UniProt

Q969Q0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL36AL Rabbit Polyclonal Antibody (orb586422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000992

Preservative

Lyophilized powder

AA Sequence

FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit
E-CL-R0669-01 24 Tests

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit

Sign In for Pricing
View Details
Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit
E-CL-R0669-02 48 Tests

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit

Sign In for Pricing
View Details
Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit
E-CL-R0669-03 96 Tests

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit

Sign In for Pricing
View Details
Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit
E-CL-R0669-04 5x 96 Tests

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit

Sign In for Pricing
View Details
Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit
E-CL-R0669-05 10x 96 Tests

Rat TFF3 -Trefoil Factor 3, Intestinal- CLIA Kit

Sign In for Pricing
View Details
PCDH-CMV-APOL1EF1A-EGFP-T2A-PURO
BZ0133-1 1 Vial

PCDH-CMV-APOL1EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details