Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR78 Peptide - C-terminal region

GPR78 Peptide - C-terminal region

Product Specifications

UniProt

Q96P69

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR78 Rabbit Polyclonal Antibody (orb586354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543009

Preservative

Lyophilized powder

AA Sequence

MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNBIP1 Human qPCR Primer Pair (NM_020248)
HP225667 200 Reactions

CTNNBIP1 Human qPCR Primer Pair (NM_020248)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504663 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Acenaphthylene
TRC-A130750-250MG 250 mg

Acenaphthylene

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF740 conjugate, 0.1mg/mL
BNC740828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), 1mg/mL
BNUM1878-50 1x 50 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), 1mg/mL

Sign In for Pricing
View Details
Zfp930 Mouse Gene Knockout Kit (CRISPR)
KN520027 1 Kit

Zfp930 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details