Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR78 Peptide - C-terminal region

GPR78 Peptide - C-terminal region

Product Specifications

UniProt

Q96P69

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR78 Rabbit Polyclonal Antibody (orb586354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543009

Preservative

Lyophilized powder

AA Sequence

MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antigen-Down ELISA Development Kit
9101 Reagents for 10x 96 Well Plates

Antigen-Down ELISA Development Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806443 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Hydroxydione
TRC-H941558-50MG 50 mg

Hydroxydione

Sign In for Pricing
View Details
PSMB10 Human Knockdown Lysate
LY300282 100 µg

PSMB10 Human Knockdown Lysate

Sign In for Pricing
View Details
Arg2 Rabbit Polyclonal Antibody
TA363002 100 µL

Arg2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2S,3R)-3-Hydroxynorleucine
TRC-H949760-10MG 10 mg

(2S,3R)-3-Hydroxynorleucine

Sign In for Pricing
View Details