Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTMT Peptide - middle region

FTMT Peptide - middle region

Product Specifications

Product Name Alternative

MTF

UniProt

Q8N4E7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTMT Rabbit Polyclonal Antibody (orb326580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_803431

Preservative

Lyophilized powder

AA Sequence

AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17-epi-Ethynyl estradiol
274950-01 1 mg

17-epi-Ethynyl estradiol

Sign In for Pricing
View Details
17-epi-Ethynyl estradiol
274950-02 2 mg

17-epi-Ethynyl estradiol

Sign In for Pricing
View Details
17-epi-Ethynyl estradiol
274950-03 5 mg

17-epi-Ethynyl estradiol

Sign In for Pricing
View Details
17-epi-Ethynyl estradiol
274950-04 10 mg

17-epi-Ethynyl estradiol

Sign In for Pricing
View Details
17-epi-Ethynyl estradiol
274950-05 25 mg

17-epi-Ethynyl estradiol

Sign In for Pricing
View Details
Anti-TRAM1 Antibody Picoband®
PA2010 100 µg/Vial

Anti-TRAM1 Antibody Picoband®

Sign In for Pricing
View Details