Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK33 Peptide - N-terminal region

STK33 Peptide - N-terminal region

Product Specifications

UniProt

Q9BYT3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK33 Rabbit Polyclonal Antibody (orb586457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112168

Preservative

Lyophilized powder

AA Sequence

VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MORC1 (NM_014429) Human Over-expression Lysate
LS027136 100 µg

MORC1 (NM_014429) Human Over-expression Lysate

Sign In for Pricing
View Details
BROX CRISPR Activation Plasmid (h2)
sc-414639-ACT-2 20 µg

BROX CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
AK2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV683359 1.0 µg DNA

AK2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit
MBS9911600-01 48 Well

Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit
MBS9911600-02 96 Well

Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit
MBS9911600-03 5x 96 Well

Camel 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details