Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK33 Peptide - N-terminal region

STK33 Peptide - N-terminal region

Product Specifications

UniProt

Q9BYT3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK33 Rabbit Polyclonal Antibody (orb586457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112168

Preservative

Lyophilized powder

AA Sequence

VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paraoxonase 2 Rabbit Monoclonal Antibody [KD Validated]
E46F62478 40 µL

Paraoxonase 2 Rabbit Monoclonal Antibody [KD Validated]

Sign In for Pricing
View Details
OLFM1 Antibody
OACA10660-50UG 50 µg

OLFM1 Antibody

Sign In for Pricing
View Details
Cyp2e1 (NM_031543) Rat Tagged ORF Clone
RR213147 10 µg

Cyp2e1 (NM_031543) Rat Tagged ORF Clone

Sign In for Pricing
View Details
MDR1 Recombinant Protein
OPCA01990-100UG 100 µg

MDR1 Recombinant Protein

Sign In for Pricing
View Details
Sheep Lymphocytic Choriomeningitis Virus Antibody IgG (LCMV-IgG) ELISA Kit
MBS9944043-01 48 Well

Sheep Lymphocytic Choriomeningitis Virus Antibody IgG (LCMV-IgG) ELISA Kit

Sign In for Pricing
View Details
Sheep Lymphocytic Choriomeningitis Virus Antibody IgG (LCMV-IgG) ELISA Kit
MBS9944043-02 96 Well

Sheep Lymphocytic Choriomeningitis Virus Antibody IgG (LCMV-IgG) ELISA Kit

Sign In for Pricing
View Details