Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK33 Peptide - N-terminal region

STK33 Peptide - N-terminal region

Product Specifications

UniProt

Q9BYT3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK33 Rabbit Polyclonal Antibody (orb586457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112168

Preservative

Lyophilized powder

AA Sequence

VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DOP1B sgRNA gene knockout kit - Lentiviral human DOP1B sgRNA gene knockout kit (100)
GTR15393148 1 Vial

Lentiviral human DOP1B sgRNA gene knockout kit - Lentiviral human DOP1B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Purified Anti-Human CD268 Antibody[H353-6G10]
AN006550P-01 25 µg

Purified Anti-Human CD268 Antibody[H353-6G10]

Sign In for Pricing
View Details
Purified Anti-Human CD268 Antibody[H353-6G10]
AN006550P-02 100 µg

Purified Anti-Human CD268 Antibody[H353-6G10]

Sign In for Pricing
View Details
Anti-TSPYL5 Antibody Picoband® Fluoro647 Conjugated
A10648-2-Fluoro647 100 µg/Vial

Anti-TSPYL5 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
IRAK1BP1 Rabbit pAb, Pacific Blue conjugated
orb2847421 100 µL

IRAK1BP1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mrps18a 3'UTR GFP Stable Cell Line
TU163468 1.0 mL

Mrps18a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details