Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZAP2 Peptide - C-terminal region

DAZAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0058, MGC14319, MGC766, PRTB

UniProt

Q15038

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAZAP2 Rabbit Polyclonal Antibody (orb586469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055579

Preservative

Lyophilized powder

AA Sequence

AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-01 0.02 mg (E-Coli)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details
Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-02 0.1 mg (E-Coli)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details
Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-03 0.02 mg (Yeast)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details
Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-04 0.1 mg (Yeast)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details
Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-05 0.02 mg (Baculovirus)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details
Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)
MBS1464565-06 1 mg (E-Coli)

Recombinant Manduca sexta Larval cuticle protein 16/17 (LCP16/17)

Sign In for Pricing
View Details