Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZAP2 Peptide - C-terminal region

DAZAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0058, MGC14319, MGC766, PRTB

UniProt

Q15038

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAZAP2 Rabbit Polyclonal Antibody (orb586469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055579

Preservative

Lyophilized powder

AA Sequence

AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igbp1 Rat shRNA Plasmid (Locus ID 58845)
TL711431 1 Kit

Igbp1 Rat shRNA Plasmid (Locus ID 58845)

Sign In for Pricing
View Details
NDUFS6 Rabbit Monoclonal Antibody
E10G21732 100 µL

NDUFS6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Conjugated SENP2 Rabbit mAb
C56775 100 µL

Conjugated SENP2 Rabbit mAb

Sign In for Pricing
View Details
Rodatristat
MBS5769937 Inquire

Rodatristat

Sign In for Pricing
View Details
Mouse anti-Claudin 7 Antibody
DL99614A-01 50 µL

Mouse anti-Claudin 7 Antibody

Sign In for Pricing
View Details
Mouse anti-Claudin 7 Antibody
DL99614A-02 100 µL

Mouse anti-Claudin 7 Antibody

Sign In for Pricing
View Details