Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPLAL1 Peptide - middle region

LYPLAL1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ99730, KIAA1238

UniProt

Q5VWZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPLAL1 Rabbit Polyclonal Antibody (orb331336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620149

Preservative

Lyophilized powder

AA Sequence

MCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanex 923
FC168194-01 10 g

Cyanex 923

Sign In for Pricing
View Details
Cyanex 923
FC168194-02 25 g

Cyanex 923

Sign In for Pricing
View Details
Cyanex 923
FC168194-03 50 g

Cyanex 923

Sign In for Pricing
View Details
Cyanex 923
FC168194-04 100 g

Cyanex 923

Sign In for Pricing
View Details
Cyanex 923
FC168194-05 250 g

Cyanex 923

Sign In for Pricing
View Details
Stromal Interaction Molecule 1 (STIM1, GOK) discontinued
S7975-88A 50 µg

Stromal Interaction Molecule 1 (STIM1, GOK) discontinued

Sign In for Pricing
View Details