Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGI4 Peptide - C-terminal region

LGI4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LGIL3

UniProt

Q8N135

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGI4 Rabbit Polyclonal Antibody (orb586198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644813

Preservative

Lyophilized powder

AA Sequence

LWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amido Berenil Hydrochloride
TRC-A611866-50MG 50 mg

1-Amido Berenil Hydrochloride

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL
BNC041711-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCN 213
TRC-T012570-50MG 50 mg

TCN 213

Sign In for Pricing
View Details
5,8-Dihydro-1-naphthol (90%)
TRC-D449375-2.5G 2.5 g

5,8-Dihydro-1-naphthol (90%)

Sign In for Pricing
View Details
Octhilinone
TRC-O239300-250MG 250 mg

Octhilinone

Sign In for Pricing
View Details
GF-1 Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 25 preps
GF-RD-025 25 Preparations

GF-1 Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 25 preps

Sign In for Pricing
View Details