Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGI4 Peptide - C-terminal region

LGI4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LGIL3

UniProt

Q8N135

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGI4 Rabbit Polyclonal Antibody (orb586198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644813

Preservative

Lyophilized powder

AA Sequence

LWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Peroxidase (GSH-Px) Activity Assay Kit
E-BC-K096-M-01 48 T (16 samples)

Glutathione Peroxidase (GSH-Px) Activity Assay Kit

Sign In for Pricing
View Details
Glutathione Peroxidase (GSH-Px) Activity Assay Kit
E-BC-K096-M-02 96 T (40 samples)

Glutathione Peroxidase (GSH-Px) Activity Assay Kit

Sign In for Pricing
View Details
C17orf67 Human Gene Knockout Kit (CRISPR)
KN417843 1 Kit

C17orf67 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin (Vitamin B7 or Vitamin H) (BTN/2032R), CF740 conjugate, 0.1mg/mL
BNC742032-500 1x 500 µL

Biotin (Vitamin B7 or Vitamin H) (BTN/2032R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF165 Human Gene Knockout Kit (CRISPR)
KN416480 1 Kit

RNF165 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Shoc2 Mouse Gene Knockout Kit (CRISPR)
KN515760 1 Kit

Shoc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details