Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESF1 Peptide - C-terminal region

ESF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABTAP, C20orf6, FLJ20368, HDCMC28P, bA526K24.1

UniProt

Q9H501

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ESF1 Rabbit Polyclonal Antibody (orb586472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057733

Preservative

Lyophilized powder

AA Sequence

QELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTEQFQARKKQKVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC02881 Human Gene Knockout Kit (CRISPR)
KN433289 1 Kit

LINC02881 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTGES2 Human Gene Knockout Kit (CRISPR)
KN402642 1 Kit

PTGES2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF740 conjugate, 0.1mg/mL
BNC742276-100 1x 100 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HINT3 (NM_138571) Human Over-expression Lysate
LY403361 100 µg

HINT3 (NM_138571) Human Over-expression Lysate

Sign In for Pricing
View Details
TOR3A antibody
FNab08874 100 µg

TOR3A antibody

Sign In for Pricing
View Details
DUSP19 (NM_001142314) Human Over-expression Lysate
LC428032 20 µg

DUSP19 (NM_001142314) Human Over-expression Lysate

Sign In for Pricing
View Details