Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESF1 Peptide - C-terminal region

ESF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABTAP, C20orf6, FLJ20368, HDCMC28P, bA526K24.1

UniProt

Q9H501

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ESF1 Rabbit Polyclonal Antibody (orb586472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057733

Preservative

Lyophilized powder

AA Sequence

QELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTEQFQARKKQKVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAR1 Antibody
8C10740-AAT 50 µg

ADAR1 Antibody

Sign In for Pricing
View Details
OR2M3 (C-term) Rabbit Polyclonal Antibody
AP53034PU-N 400 µL

OR2M3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARL17B (ARL17A) Human Gene Knockout Kit (CRISPR)
KN425073 1 Kit

ARL17B (ARL17A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Mucin 20 (MUC20) ELISA Kit
RD-MUC20-Hu-01 96 Tests

Human Mucin 20 (MUC20) ELISA Kit

Sign In for Pricing
View Details
Human Mucin 20 (MUC20) ELISA Kit
RD-MUC20-Hu-02 48 Tests

Human Mucin 20 (MUC20) ELISA Kit

Sign In for Pricing
View Details
Spsb4 Mouse Gene Knockout Kit (CRISPR)
KN516678 1 Kit

Spsb4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details