Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM2 Peptide - N-terminal region

ECM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126355, MGC126356

UniProt

O94769

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECM2 Rabbit Polyclonal Antibody (orb326550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001184225

Preservative

Lyophilized powder

AA Sequence

FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCOF1 Protein Vector (Human) (pPM-C-HA)
PV041575 500 ng

TCOF1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EIF4G1 Adenovirus (Mouse)
19172055 1.0 mL

EIF4G1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human PSMD11 Protein, GST, E.coli-200ug
QP8324-ec-200ug 200ug

Recombinant Human PSMD11 Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
Anti-PON1 Antibody Picoband® (Dylight488 Conjugate)
A00516-4-Dylight488 100 µg

Anti-PON1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)
MBS1396998-01 0.02 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)
MBS1396998-02 0.1 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)

Sign In for Pricing
View Details