Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM2 Peptide - N-terminal region

ECM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126355, MGC126356

UniProt

O94769

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECM2 Rabbit Polyclonal Antibody (orb326550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001184225

Preservative

Lyophilized powder

AA Sequence

FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM263 siRNA (Human)
CRJ3952-01 15 nmol

TMEM263 siRNA (Human)

Sign In for Pricing
View Details
TMEM263 siRNA (Human)
CRJ3952-02 30 nmol

TMEM263 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human ErbB-3/HER3 Protein
RP00083-01 10 μg

Recombinant Human ErbB-3/HER3 Protein

Sign In for Pricing
View Details
Recombinant Human ErbB-3/HER3 Protein
RP00083-02 20 μg

Recombinant Human ErbB-3/HER3 Protein

Sign In for Pricing
View Details
Recombinant Human ErbB-3/HER3 Protein
RP00083-03 50 μg

Recombinant Human ErbB-3/HER3 Protein

Sign In for Pricing
View Details
Recombinant Human ErbB-3/HER3 Protein
RP00083-04 100 μg

Recombinant Human ErbB-3/HER3 Protein

Sign In for Pricing
View Details