Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcan1 Peptide - N-terminal region

Rcan1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dscr1, Mcip1

UniProt

D4A142

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rcan1 Rabbit Polyclonal Antibody (orb573870) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM10766

Preservative

Lyophilized powder

AA Sequence

HLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride
290030-01 2 mg

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride

Sign In for Pricing
View Details
1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride
290030-02 5 mg

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride

Sign In for Pricing
View Details
1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride
290030-03 10 mg

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride

Sign In for Pricing
View Details
1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride
290030-04 25 mg

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride

Sign In for Pricing
View Details
1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride
290030-05 50 mg

1,2,3,4-Tetrahydro-8-isoquinolinol hydrochloride

Sign In for Pricing
View Details
LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1) (FITC)
MBS6148000-01 0.1 mL

LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1) (FITC)

Sign In for Pricing
View Details