Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Peptide - C-terminal region

Pou3f1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Oct-6, Otf6, Scip, Testes-1, Tst-1

UniProt

P20267

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou3f1 Rabbit Polyclonal Antibody (orb574493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620193

Preservative

Lyophilized powder

AA Sequence

CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA2 Recombinant Rabbit Monoclonal Antibody [JM10-64]
ET1703-76 100 µL

FOXA2 Recombinant Rabbit Monoclonal Antibody [JM10-64]

Sign In for Pricing
View Details
N-Acetyl-1,3-propanediamine
TRC-A165390-250MG 250 mg

N-Acetyl-1,3-propanediamine

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]
AM50261PU-T 20 µg

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]

Sign In for Pricing
View Details
Mosapride
TRC-M731000-10MG 10 mg

Mosapride

Sign In for Pricing
View Details
ETS1 associated protein II (TDP2) Human Gene Knockout Kit (CRISPR)
KN202015BN 1 Kit

ETS1 associated protein II (TDP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRM1 (NM_002761) Human Over-expression Lysate
LY419125 100 µg

PRM1 (NM_002761) Human Over-expression Lysate

Sign In for Pricing
View Details