Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Peptide - C-terminal region

Pou3f1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Oct-6, Otf6, Scip, Testes-1, Tst-1

UniProt

P20267

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou3f1 Rabbit Polyclonal Antibody (orb574493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620193

Preservative

Lyophilized powder

AA Sequence

CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUL9 Antibody
KC-3303-01 50 μL

CUL9 Antibody

Sign In for Pricing
View Details
CUL9 Antibody
KC-3303-02 100 µL

CUL9 Antibody

Sign In for Pricing
View Details
CUL9 Antibody
KC-3303-03 1 mL

CUL9 Antibody

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL
BNC742313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF568 conjugate, 0.1mg/mL
BNC682418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Etoricoxib N-1,1’-Dioxide
TRC-E934110-50MG 50 mg

Etoricoxib N-1,1’-Dioxide

Sign In for Pricing
View Details