Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btbd3 Peptide - C-terminal region

Btbd3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC25591, mKIAA0952

UniProt

Q3TSN9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Btbd3 Rabbit Polyclonal Antibody (orb575237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020602

Preservative

Lyophilized powder

AA Sequence

LKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVVLDGNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conserved Oligomeric Golgi Complex Subunit 4 (COG4) Antibody
abx033392-01 80 µL

Conserved Oligomeric Golgi Complex Subunit 4 (COG4) Antibody

Sign In for Pricing
View Details
Conserved Oligomeric Golgi Complex Subunit 4 (COG4) Antibody
abx033392-02 400 µL

Conserved Oligomeric Golgi Complex Subunit 4 (COG4) Antibody

Sign In for Pricing
View Details
ADORA3 Peptide - C-terminal region
orb2011886 100 µg

ADORA3 Peptide - C-terminal region

Sign In for Pricing
View Details
Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)
ARP6250-01 10 µg

Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)
ARP6250-02 50 µg

Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)
ARP6250-03 100 µg

Recombinant Human EED / Embryonic Ectoderm Development Protein (His & GST tag)

Sign In for Pricing
View Details