Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btbd3 Peptide - C-terminal region

Btbd3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC25591, mKIAA0952

UniProt

Q3TSN9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Btbd3 Rabbit Polyclonal Antibody (orb575237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020602

Preservative

Lyophilized powder

AA Sequence

LKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVVLDGNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Haptoglobin (Hpt) ELISA Kit
EKL61730 96 Tests

Bovine Haptoglobin (Hpt) ELISA Kit

Sign In for Pricing
View Details
RUNDC3B (NM_138290) Human Untagged Clone
SC313630 10 µg

RUNDC3B (NM_138290) Human Untagged Clone

Sign In for Pricing
View Details
2610318N02Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10475114 3x 1.0 µg

2610318N02Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat Col6a1 Pre-designed siRNA Set B
SI203070B 1 Each

Rat Col6a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CENP-H Lentiviral Activation Particles (h)
sc-404498-LAC 200 µL

CENP-H Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Monkey Olfactory receptor 2T33 (OR2T33) ELISA Kit
GTR10478980-01 48 Well

Monkey Olfactory receptor 2T33 (OR2T33) ELISA Kit

Sign In for Pricing
View Details