Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycbp Peptide - C-terminal region

Mycbp Peptide - C-terminal region

Product Specifications

Product Name Alternative

5730488M09Rik, AW552132, AW742590, Amy-1

UniProt

Q9EQS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mycbp Rabbit Polyclonal Antibody (orb576035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062634

Preservative

Lyophilized powder

AA Sequence

HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lawesson’s Reagent
TRC-L178780-50G 50 g

Lawesson’s Reagent

Sign In for Pricing
View Details
Zinc 2-Mercaptobenzothiazole
TRC-Z701568-5G 5 g

Zinc 2-Mercaptobenzothiazole

Sign In for Pricing
View Details
Ceturegel™ Matrix hESC-Qualified,LDEV-Free
40190ES08 5 mL

Ceturegel™ Matrix hESC-Qualified,LDEV-Free

Sign In for Pricing
View Details
P2RY2 Polyclonal Antibody
E-AB-13480-01 20 µL

P2RY2 Polyclonal Antibody

Sign In for Pricing
View Details
P2RY2 Polyclonal Antibody
E-AB-13480-02 60 µL

P2RY2 Polyclonal Antibody

Sign In for Pricing
View Details
P2RY2 Polyclonal Antibody
E-AB-13480-03 120 µL

P2RY2 Polyclonal Antibody

Sign In for Pricing
View Details