Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycbp Peptide - C-terminal region

Mycbp Peptide - C-terminal region

Product Specifications

Product Name Alternative

5730488M09Rik, AW552132, AW742590, Amy-1

UniProt

Q9EQS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mycbp Rabbit Polyclonal Antibody (orb576035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062634

Preservative

Lyophilized powder

AA Sequence

HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP (TRAIP) (C-term) Goat Polyclonal Antibody
AP31057PU-N 100 µg

TRIP (TRAIP) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD34 Rabbit Polyclonal Antibody
AP20634PU-N 100 µg

CD34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM176A antibody
FNab08761 100 µg

TMEM176A antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707829 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Rad51 Mouse Gene Knockout Kit (CRISPR)
KN514414 1 Kit

Rad51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP512299 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details