Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adnp2 Peptide - N-terminal region

Adnp2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC188386, RGD1308279

UniProt

B2GVB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Adnp2 Rabbit Polyclonal Antibody (orb576982) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120845

Preservative

Lyophilized powder

AA Sequence

MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELLKDLKGFDPGEKYFCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARTS1 (ERAP1) (NM_016442) Human Tagged Lenti ORF Clone
RC214469L1 10 µg

ARTS1 (ERAP1) (NM_016442) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr332 AAV siRNA Pooled Vector
34321166 1.0 µg

Olr332 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rab37 ORF Vector (Mouse) (pORF)
38328014 1.0 µg DNA

Rab37 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Kinesis VHP Ftg 1/16in FngrTt 10pk
CHR5291 1 Each

Kinesis VHP Ftg 1/16in FngrTt 10pk

Sign In for Pricing
View Details
CHD8 sgRNA CRISPR Lentivector (Human) (Target 1)
K0443402 1.0 µg DNA

CHD8 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Anti-MSK1 (Phospho-S360) Rabbit mAb
CMA9097-01 30 µL

Recombinant Anti-MSK1 (Phospho-S360) Rabbit mAb

Sign In for Pricing
View Details