Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME3 Peptide - N-terminal region

PSME3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ki, PA28-gamma, PA28G, REG-GAMMA

UniProt

P61289

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSME3 Rabbit Polyclonal Antibody (orb330469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_789839

Preservative

Lyophilized powder

AA Sequence

PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pokemon Polyclonal Antibody, Cy5.5 Conjugated
bs-10235R-Cy5.5 100 µL

Pokemon Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-NCOA2 Antibody Picoband®, Dylight550 Conjugate
A01706-2-Dylight550 100 µg

Anti-NCOA2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit
MBS7266520-01 48 Well

Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit
MBS7266520-02 96 Well

Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit
MBS7266520-03 5x 96 Well

Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit
MBS7266520-04 10x 96 Well

Sheep Serine/Threonine-Protein Phosphatase PP1-alpha Catalytic Subunit ELISA Kit

Sign In for Pricing
View Details