Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csnk1a1 Peptide - N-terminal region

Csnk1a1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC156603

UniProt

P97633

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Csnk1a1 Rabbit Polyclonal Antibody (orb330643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446067

Preservative

Lyophilized powder

AA Sequence

FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS12, NT (RPS12, 40S ribosomal protein S12) (MaxLight 750) discontinued
041232-ML750 100 µL

RPS12, NT (RPS12, 40S ribosomal protein S12) (MaxLight 750) discontinued

Sign In for Pricing
View Details
STK11, phosphorylated (Ser307) (Serine/threonine kinase 11, LKB1, PJS, Renal carcinoma antigen NY-REN-19, Serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1) (MaxLight 750) discontinued
S7973-58Y3-ML750 100 µL

STK11, phosphorylated (Ser307) (Serine/threonine kinase 11, LKB1, PJS, Renal carcinoma antigen NY-REN-19, Serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GhrB Antibody
orb816500 2 mg

GhrB Antibody

Sign In for Pricing
View Details
pPLPR-OmpA-TSHR-6×His Plasmid
PVT57605 2 µg

pPLPR-OmpA-TSHR-6×His Plasmid

Sign In for Pricing
View Details
Apelin-13 (human, bovine, mouse, rat)
H-4566.0005 5.0mg

Apelin-13 (human, bovine, mouse, rat)

Sign In for Pricing
View Details
Mouse Monoclonal Rad21 Antibody (CM110-2C10)
NB100-386SS 0.025 mL

Mouse Monoclonal Rad21 Antibody (CM110-2C10)

Sign In for Pricing
View Details