Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csnk1a1 Peptide - N-terminal region

Csnk1a1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC156603

UniProt

P97633

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Csnk1a1 Rabbit Polyclonal Antibody (orb330643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446067

Preservative

Lyophilized powder

AA Sequence

FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD8b/Lyt3 Antibody (35.17.2#)
FMC84720 100 μg

Anti-Mouse CD8b/Lyt3 Antibody (35.17.2#)

Sign In for Pricing
View Details
Lentiviral human SPEF1 shRNA (UAS) - Lentiviral human SPEF1 shRNA (UAS) plasmid
GTR15091927 1 Vial

Lentiviral human SPEF1 shRNA (UAS) - Lentiviral human SPEF1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
SLC36A1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2455640 100 µL

SLC36A1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Choline Acetyltransferase (CHAT) (NM_020986) Human Tagged ORF Clone
RC217232 10 µg

Choline Acetyltransferase (CHAT) (NM_020986) Human Tagged ORF Clone

Sign In for Pricing
View Details
P21-ARC Polyclonal Antibody, HRP Conjugated
bs-17589R-HRP 100 µL

P21-ARC Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit Olfactory receptor 6X1 (OR6X1) ELISA Kit
MBS7235347-01 48 Well

Rabbit Olfactory receptor 6X1 (OR6X1) ELISA Kit

Sign In for Pricing
View Details