Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbe1 Peptide - N-terminal region

Hbe1 Peptide - N-terminal region

Product Specifications

UniProt

O88752

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hbe1 Rabbit Polyclonal Antibody (orb582284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008890

Preservative

Lyophilized powder

AA Sequence

MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG2 (Immunoglobulin G2) ELISA Kit
E-EL-H6161-01 24 Tests

Human IgG2 (Immunoglobulin G2) ELISA Kit

Sign In for Pricing
View Details
Human IgG2 (Immunoglobulin G2) ELISA Kit
E-EL-H6161-02 48 Tests

Human IgG2 (Immunoglobulin G2) ELISA Kit

Sign In for Pricing
View Details
Human IgG2 (Immunoglobulin G2) ELISA Kit
E-EL-H6161-03 96 Tests

Human IgG2 (Immunoglobulin G2) ELISA Kit

Sign In for Pricing
View Details
Melanoma Inhibitory Activity (MIA) Rabbit Polyclonal Antibody
TA360826 100 µL

Melanoma Inhibitory Activity (MIA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712265 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
tert-Butyl-d9-amine
TRC-B690777-500MG 500 mg

tert-Butyl-d9-amine

Sign In for Pricing
View Details