Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbe1 Peptide - N-terminal region

Hbe1 Peptide - N-terminal region

Product Specifications

UniProt

O88752

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hbe1 Rabbit Polyclonal Antibody (orb582284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008890

Preservative

Lyophilized powder

AA Sequence

MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotensin Receptor 1 (NTSR1) Human Gene Knockout Kit (CRISPR)
KN220548LP 1 Kit

Neurotensin Receptor 1 (NTSR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARMC5 (NM_001301820) Human Tagged ORF Clone
RG239833 10 µg

ARMC5 (NM_001301820) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin-20 Antibody
KC-1238-01 50 μL

Cytokeratin-20 Antibody

Sign In for Pricing
View Details
Cytokeratin-20 Antibody
KC-1238-02 100 µL

Cytokeratin-20 Antibody

Sign In for Pricing
View Details
Cytokeratin-20 Antibody
KC-1238-03 1 mL

Cytokeratin-20 Antibody

Sign In for Pricing
View Details
Rat SELE (E-selectin) ELISA Kit
E-EL-R0893-01 24 Tests

Rat SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details