Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbe1 Peptide - N-terminal region

Hbe1 Peptide - N-terminal region

Product Specifications

UniProt

O88752

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hbe1 Rabbit Polyclonal Antibody (orb582284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008890

Preservative

Lyophilized powder

AA Sequence

MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3096-05S 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
5-Hydroxy Lansoprazole Sulfide
TRC-H943715-500MG 500 mg

5-Hydroxy Lansoprazole Sulfide

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: CC63]
AM05901FC-N 100 Tests

CD8A Mouse Monoclonal Antibody [Clone ID: CC63]

Sign In for Pricing
View Details
(11Beta)-11,17a-Dihydroxy-D-homoandrosta-1,4-diene-3,17-dione
TRC-D452853-5MG 5 mg

(11Beta)-11,17a-Dihydroxy-D-homoandrosta-1,4-diene-3,17-dione

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF640R conjugate, 0.1mg/mL
BNC401389-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GCN2 Antibody
RC-16423-01 50 μL

Recombinant GCN2 Antibody

Sign In for Pricing
View Details