Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Peptide - C-terminal region

ZER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf60, Hzyg, RP11-545E17.4, ZYG, ZYG11BL

UniProt

Q7Z7L7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZER1 Rabbit Polyclonal Antibody (orb326291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006327

Preservative

Lyophilized powder

AA Sequence

YCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometrium
CR561119 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Human C1orf198 activation kit by CRISPRa
GA113739 1 Kit

Human C1orf198 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS645953 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Human C11orf10 (TMEM258) activation kit by CRISPRa
GA100519 1 Kit

Human C11orf10 (TMEM258) activation kit by CRISPRa

Sign In for Pricing
View Details
MARS2 Human Gene Knockout Kit (CRISPR)
KN424966 1 Kit

MARS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details