Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Peptide - C-terminal region

ZER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf60, Hzyg, RP11-545E17.4, ZYG, ZYG11BL

UniProt

Q7Z7L7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZER1 Rabbit Polyclonal Antibody (orb326291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006327

Preservative

Lyophilized powder

AA Sequence

YCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), 1mg/mL
BNUM1919-50 1x 50 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), 1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF700 conjugate, 0.1mg/mL
BNC000904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Brexpiprazole 5-1H-Quinolin-2-one
TRC-B677428-250MG 250 mg

Brexpiprazole 5-1H-Quinolin-2-one

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS628775 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Ice Flaker BIFL-207
BIFL-207 1 Unit

Ice Flaker BIFL-207

Sign In for Pricing
View Details
PIGT (NM_001184728) Human Over-expression Lysate
LY433225 100 µg

PIGT (NM_001184728) Human Over-expression Lysate

Sign In for Pricing
View Details