Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHTKD1 Peptide - N-terminal region

DHTKD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp762M115, KIAA1630, MGC3090

UniProt

Q96HY7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHTKD1 Rabbit Polyclonal Antibody (orb585424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061176

Preservative

Lyophilized powder

AA Sequence

YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9,10-Dihydro-9,10-ethanoanthracene-9-carboxylic Acid
TRC-D450515-25MG 25 mg

9,10-Dihydro-9,10-ethanoanthracene-9-carboxylic Acid

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-01 50 μL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-02 100 µL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-03 1 mL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
C6orf58 (NM_001010905) Human Over-expression Lysate
LC423220 20 µg

C6orf58 (NM_001010905) Human Over-expression Lysate

Sign In for Pricing
View Details
Fumonisin B1
TRC-F862750-5MG 5 mg

Fumonisin B1

Sign In for Pricing
View Details