Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHTKD1 Peptide - N-terminal region

DHTKD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp762M115, KIAA1630, MGC3090

UniProt

Q96HY7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHTKD1 Rabbit Polyclonal Antibody (orb585424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061176

Preservative

Lyophilized powder

AA Sequence

YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL
BNC682649-500 1x 500 µL

MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-SPS | Sucrose phosphate synthase, global, DyLight® 594 conjugated (40 µg)
AS03 035-DL594 40 µg

Anti-SPS | Sucrose phosphate synthase, global, DyLight® 594 conjugated (40 µg)

Sign In for Pricing
View Details
PCTAIRE3 (CDK18) Human Gene Knockout Kit (CRISPR)
KN402150 1 Kit

PCTAIRE3 (CDK18) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cilnidipine
TRC-C441375-10MG 10 mg

Cilnidipine

Sign In for Pricing
View Details
MCF2L2 Antibody
KC-2717-01 50 μL

MCF2L2 Antibody

Sign In for Pricing
View Details
MCF2L2 Antibody
KC-2717-02 100 µL

MCF2L2 Antibody

Sign In for Pricing
View Details