Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTF2 Peptide - middle region

NUTF2 Peptide - middle region

Product Specifications

Product Name Alternative

NTF2, PP15

UniProt

P61970

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTF2 Rabbit Polyclonal Antibody (orb586091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005787

Preservative

Lyophilized powder

AA Sequence

KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pex1 3'UTR GFP Stable Cell Line
TU166203 1.0 mL

Pex1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human FNDC9 Knockout HEK293T cell line
GTR15412241 1 Vial

Human FNDC9 Knockout HEK293T cell line

Sign In for Pricing
View Details
BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (MaxLight 405)
MBS6194086-01 0.1 mL

BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (MaxLight 405)

Sign In for Pricing
View Details
BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (MaxLight 405)
MBS6194086-02 5x 0.1 mL

BLK (B lymphoid Tyrosine Kinase, MGC10442, BLK Nonreceptor Tyrosine Kinase) (MaxLight 405)

Sign In for Pricing
View Details
OVOL3 Protein Vector (Human) (pPB-C-His)
PV109318 500 ng

OVOL3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CDK5RAP1 Peptide - N-terminal region
orb2003242 100 µg

CDK5RAP1 Peptide - N-terminal region

Sign In for Pricing
View Details