NUTF2 Peptide - middle region
NUTF2 Peptide - middle region
Product Specifications
Product Name Alternative
NTF2, PP15
UniProt
P61970
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUTF2 Rabbit Polyclonal Antibody (orb586091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005787
Preservative
Lyophilized powder
AA Sequence
KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124917-ML405 100 µL
CGR19 (Cell Growth Regulator with RING Finger Domain Protein 1, Cell Growth Regulatory Gene 19 Protein, RING Finger Protein 197, CGRRF1, RNF197) (MaxLight 405) discontinued
Sign In for Pricing
View Details A1378-86 1 mg
2-Amino-3- (trideuteromethyl) -3H-Imidazo[4,5-F]-quinoline
Sign In for Pricing
View Details 
MBS7097892-01 0.05 mg (E-Coli)
Recombinant Conus pennaceus Conotoxin PnMRCL-0111
Sign In for Pricing
View Details MBS7097892-02 0.2 mg (E-Coli)
Recombinant Conus pennaceus Conotoxin PnMRCL-0111
Sign In for Pricing
View Details MBS7097892-03 0.5 mg (E-Coli)
Recombinant Conus pennaceus Conotoxin PnMRCL-0111
Sign In for Pricing
View Details