Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG2 Peptide - C-terminal region

STAG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686P168, DKFZp781H1753, FLJ25871, SA-2, SA2, bA517O1.1, SCC3B

UniProt

Q8N3U4

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAG2 Rabbit Polyclonal Antibody (orb331332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006594

Preservative

Lyophilized powder

AA Sequence

LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMA2 (Biotin)
566913-01 50 µg

LAMA2 (Biotin)

Sign In for Pricing
View Details
LAMA2 (Biotin)
566913-02 100 µg

LAMA2 (Biotin)

Sign In for Pricing
View Details
SLC22A4 Peptide
DF9724-BP 1 mg

SLC22A4 Peptide

Sign In for Pricing
View Details
TH, Phosphorylated (S19) (Tyrosine Hydroxylase, TYH, DYT14, DYT5b, Tyrosine 3-Monooxygenase, Tyrosine 3-Hydroxylase) (AP)
MBS6440510-01 0.1 mL

TH, Phosphorylated (S19) (Tyrosine Hydroxylase, TYH, DYT14, DYT5b, Tyrosine 3-Monooxygenase, Tyrosine 3-Hydroxylase) (AP)

Sign In for Pricing
View Details
TH, Phosphorylated (S19) (Tyrosine Hydroxylase, TYH, DYT14, DYT5b, Tyrosine 3-Monooxygenase, Tyrosine 3-Hydroxylase) (AP)
MBS6440510-02 5x 0.1 mL

TH, Phosphorylated (S19) (Tyrosine Hydroxylase, TYH, DYT14, DYT5b, Tyrosine 3-Monooxygenase, Tyrosine 3-Hydroxylase) (AP)

Sign In for Pricing
View Details
BLRF2
MBS505064-01 1 mg

BLRF2

Sign In for Pricing
View Details