Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG2 Peptide - C-terminal region

STAG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686P168, DKFZp781H1753, FLJ25871, SA-2, SA2, bA517O1.1, SCC3B

UniProt

Q8N3U4

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAG2 Rabbit Polyclonal Antibody (orb331332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006594

Preservative

Lyophilized powder

AA Sequence

LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound N062-0008
MBS5796152 Inquire

Compound N062-0008

Sign In for Pricing
View Details
KCNK16 Rabbit Polyclonal Antibody (Cy5)
orb947521 100 µL

KCNK16 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
[5- (aminosulfonyl) thien-2-yl]acetic acid
sc-350205A 1 g

[5- (aminosulfonyl) thien-2-yl]acetic acid

Sign In for Pricing
View Details
TNFRSF11B, His, Human
Z05898-500 500 µg

TNFRSF11B, His, Human

Sign In for Pricing
View Details
CD140a Mouse Monoclonal Antibody
AMM82029-01 1 Each

CD140a Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD140a Mouse Monoclonal Antibody
AMM82029-02 50 µL

CD140a Mouse Monoclonal Antibody

Sign In for Pricing
View Details