CABP5 Peptide - N-terminal region
CABP5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CABP3
UniProt
Q9NP86
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CABP5 Rabbit Polyclonal Antibody (orb586466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062829
Preservative
Lyophilized powder
AA Sequence
RKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY431782 100 µg
Guanylate kinase (GUK1) (NM_001159391) Human Over-expression Lysate
Sign In for Pricing
View Details 
GP-7801-5 1 mL
Colloidal Gold Conjugated Maackia amurensis Lectin -MAA-, 5nm
Sign In for Pricing
View Details ![Transketolase (TKT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H3]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3ef042/imageurl/ta500892am.webp)
TA500892AM 100 µL
Transketolase (TKT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H3]
Sign In for Pricing
View Details 
BNC431221-100 1x 100 µL
Cytokeratin 8/18 (B22.1 + B23.1), CF543 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP20936PU-N 100 µg
DNA PKcs (PRKDC) pTyr2609 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details