Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5 Peptide - N-terminal region

CABP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CABP3

UniProt

Q9NP86

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABP5 Rabbit Polyclonal Antibody (orb586466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062829

Preservative

Lyophilized powder

AA Sequence

RKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMTC2 Human qPCR Primer Pair (NM_152588)
HP217823 200 Reactions

TMTC2 Human qPCR Primer Pair (NM_152588)

Sign In for Pricing
View Details
Wisteria floribunda Gel -WFA- Immobilized Lectin
AK-3101-2 2 mL

Wisteria floribunda Gel -WFA- Immobilized Lectin

Sign In for Pricing
View Details
LCK Human Gene Knockout Kit (CRISPR)
KN219375LP 1 Kit

LCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL
BNC402312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF640R conjugate, 0.1mg/mL
BNC402362-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Peripheral nerve
CS801063 5x 5 µm

Tissue FFPE Sections, Peripheral nerve

Sign In for Pricing
View Details