Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBOV1 Peptide - N-terminal region

PBOV1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UC28, UROC28, dJ171N11.2

UniProt

Q9GZY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PBOV1 Rabbit Polyclonal Antibody (orb586503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067648

Preservative

Lyophilized powder

AA Sequence

RAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS744600-01 48 Well

Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details
Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS744600-02 96 Well

Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details
Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS744600-03 5x 96 Well

Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details
Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS744600-04 10x 96 Well

Goat Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details
Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit
EKN52111-01 48 Tests

Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit

Sign In for Pricing
View Details
Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit
EKN52111-02 96 Tests

Human Inner Mitochondrial Membrane Peptidase 2 Like Protein (IMMP2L) ELISA Kit

Sign In for Pricing
View Details