Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBOV1 Peptide - N-terminal region

PBOV1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UC28, UROC28, dJ171N11.2

UniProt

Q9GZY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PBOV1 Rabbit Polyclonal Antibody (orb586503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067648

Preservative

Lyophilized powder

AA Sequence

RAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Sonnei mltC Protein (aa 17-359)
VAng-Lsx09886-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei mltC Protein (aa 17-359)

Sign In for Pricing
View Details
NARG1L CRISPR/Cas9 KO Plasmid (m)
sc-426253 20 µg

NARG1L CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
TEX19.2 shRNA (m) Lentiviral Particles
sc-154218-V 200 µL

TEX19.2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rat Monoclonal GDF-5/BMP-14 Antibody (RM0242-13J15) [PerCP]
NBP2-12333PCP 0.1 mL

Rat Monoclonal GDF-5/BMP-14 Antibody (RM0242-13J15) [PerCP]

Sign In for Pricing
View Details
Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit-Sandwich
EK6F457-01 48 Test

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit-Sandwich
EK6F457-02 96 Tests

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit-Sandwich

Sign In for Pricing
View Details