Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGMN Peptide - middle region

LGMN Peptide - middle region

Product Specifications

Product Name Alternative

AEP, LGMN1, PRSC1

UniProt

Q99538

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGMN Rabbit Polyclonal Antibody (orb586552) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005597

Preservative

Lyophilized powder

AA Sequence

ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/iFluor® 750 Anti-human CD140b Antibody *18A2*
114011F1-AAT 100 Tests

APC/iFluor® 750 Anti-human CD140b Antibody *18A2*

Sign In for Pricing
View Details
TRAP-δ CRISPR/Cas9 KO Plasmid (m)
sc-423165 20 µg

TRAP-δ CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC155 Antibody
NBP1-81992-25ul 25 µL

Rabbit Polyclonal CCDC155 Antibody

Sign In for Pricing
View Details
Microtubule-Associated Protein Tau (MAPT) Antibody
abx451887 100 µg

Microtubule-Associated Protein Tau (MAPT) Antibody

Sign In for Pricing
View Details
Pleated Cartridge, PTFE phobic,0.2μm, P Ster Gr,30", OD:69mm,226/Spear Fin, Polypro, EPDM, SS reinforced, Rev.0
CFPPT0020Y300AG5PEY0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Pleated Cartridge, PTFE phobic,0.2μm, P Ster Gr,30", OD:69mm,226/Spear Fin, Polypro, EPDM, SS reinforced, Rev.0

Sign In for Pricing
View Details
Ara-Cytidine-5′-diphosphate (ara-CDP), S pack
JBS-NU-1171S 50 μL

Ara-Cytidine-5′-diphosphate (ara-CDP), S pack

Sign In for Pricing
View Details