TESK2 Peptide - C-terminal region
TESK2 Peptide - C-terminal region
Product Specifications
UniProt
Q96S53
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TESK2 Rabbit Polyclonal Antibody (orb331353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009101
Preservative
Lyophilized powder
AA Sequence
AHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7228497-01 48 Well
Rabbit Centromere protein M (CENPM) ELISA Kit
Sign In for Pricing
View Details MBS7228497-02 96 Well
Rabbit Centromere protein M (CENPM) ELISA Kit
Sign In for Pricing
View Details MBS7228497-03 5x 96 Well
Rabbit Centromere protein M (CENPM) ELISA Kit
Sign In for Pricing
View Details MBS7228497-04 10x 96 Well
Rabbit Centromere protein M (CENPM) ELISA Kit
Sign In for Pricing
View Details 
MBS1333363-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Putative flavin-containing monooxygenase FMO GS-OX-like 10 (At1g63340)
Sign In for Pricing
View Details MBS1333363-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Putative flavin-containing monooxygenase FMO GS-OX-like 10 (At1g63340)
Sign In for Pricing
View Details