Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCARE Peptide - C-terminal region

PCARE Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP54, C2orf71

UniProt

A6NGG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCARE Rabbit Polyclonal Antibody (orb586588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025054

Preservative

Lyophilized powder

AA Sequence

SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACMSD shRNA (UAS) - Lentiviral human ACMSD shRNA (UAS, RFP) (100)
GTR15121416 1 Vial

Lentiviral human ACMSD shRNA (UAS) - Lentiviral human ACMSD shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
XFD594 Anti-human CD203c Antibody *NP4D6*
12030161-AAT 500 Tests

XFD594 Anti-human CD203c Antibody *NP4D6*

Sign In for Pricing
View Details
Rat Monoclonal CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (312830) [mFluor Violet 500 SE]
FAB2555MFV500 0.1 mL

Rat Monoclonal CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (312830) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Recombinant Human Dysbindin domain-containing protein 1, His-SUMO, E.coli-200ug
QP8060-ec-200ug 200ug

Recombinant Human Dysbindin domain-containing protein 1, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
MED28 Rabbit Polyclonal Antibody (Fluoro550)
orb3098537 100 µg

MED28 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Glucans biosynthesis glucosyltransferase H (opgH), partial
MBS7098430 Inquire

Recombinant Vibrio cholerae serotype O1 Glucans biosynthesis glucosyltransferase H (opgH), partial

Sign In for Pricing
View Details