PCARE Peptide - C-terminal region
PCARE Peptide - C-terminal region
Product Specifications
Product Name Alternative
RP54, C2orf71
UniProt
A6NGG8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCARE Rabbit Polyclonal Antibody (orb586588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025054
Preservative
Lyophilized powder
AA Sequence
SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15121416 1 Vial
Lentiviral human ACMSD shRNA (UAS) - Lentiviral human ACMSD shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
FAB2555MFV500 0.1 mL
Rat Monoclonal CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (312830) [mFluor Violet 500 SE]
Sign In for Pricing
View Details QP8060-ec-200ug 200ug
Recombinant Human Dysbindin domain-containing protein 1, His-SUMO, E.coli-200ug
Sign In for Pricing
View Details 
MBS7098430 Inquire
Recombinant Vibrio cholerae serotype O1 Glucans biosynthesis glucosyltransferase H (opgH), partial
Sign In for Pricing
View Details