Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCARE Peptide - C-terminal region

PCARE Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP54, C2orf71

UniProt

A6NGG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCARE Rabbit Polyclonal Antibody (orb586588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025054

Preservative

Lyophilized powder

AA Sequence

SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hdgfl1 shRNA (UAS) - Lentiviral mouse Hdgfl1 shRNA (UAS, RFP) (100)
GTR15138468 1 Vial

Lentiviral mouse Hdgfl1 shRNA (UAS) - Lentiviral mouse Hdgfl1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
UNC13B Rabbit Polyclonal Antibody
TA308990 100 µL

UNC13B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smad4 Antibody
MBS855183-01 0.1 mg

Smad4 Antibody

Sign In for Pricing
View Details
Smad4 Antibody
MBS855183-02 0.1 mL (AF635)

Smad4 Antibody

Sign In for Pricing
View Details
Smad4 Antibody
MBS855183-03 0.1 mL (AF610)

Smad4 Antibody

Sign In for Pricing
View Details
Smad4 Antibody
MBS855183-04 0.1 mL (AF405S)

Smad4 Antibody

Sign In for Pricing
View Details