Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCARE Peptide - C-terminal region

PCARE Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP54, C2orf71

UniProt

A6NGG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCARE Rabbit Polyclonal Antibody (orb586588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025054

Preservative

Lyophilized powder

AA Sequence

SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CXCR3 Antibody (49801) [Allophycocyanin/Cy7]
FAB160APCCY7 0.1 mL

Mouse Monoclonal CXCR3 Antibody (49801) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Mouse CX31 ELISA Kit
MBS8427375 Inquire

Mouse CX31 ELISA Kit

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Recombinant, Rat
155489-01 10 µg

Kallikrein 1 (KLK1) Recombinant, Rat

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Recombinant, Rat
155489-02 50 µg

Kallikrein 1 (KLK1) Recombinant, Rat

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Recombinant, Rat
155489-03 200 µg

Kallikrein 1 (KLK1) Recombinant, Rat

Sign In for Pricing
View Details
Impdh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3825706 1.0 µg DNA

Impdh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details