CSPP1 Peptide - N-terminal region
CSPP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CSPP, FLJ22490, FLJ38886
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSPP1 Rabbit Polyclonal Antibody (orb586599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079066
Preservative
Lyophilized powder
AA Sequence
AEDKAELESDPPYMEMKGKLSAKLSENSKILISMAKENIPPNSQQTRGSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725196 100 µL
Human CCL2 / MCP-1 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
BNUB0637-500 1x 500 µL
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL
Sign In for Pricing
View Details 
LC402524 20 µg
Apc5 (ANAPC5) (NM_016237) Human Over-expression Lysate
Sign In for Pricing
View Details