Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Peptide - middle region

HSPB11 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf41, HSPCO34, PP25, IFT25

UniProt

Q9Y547

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB11 Rabbit Polyclonal Antibody (orb326616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057210

Preservative

Lyophilized powder

AA Sequence

IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMSAP1L1 (CAMSAP2) (NM_001297708) Human Tagged ORF Clone
RG240157 10 µg

CAMSAP1L1 (CAMSAP2) (NM_001297708) Human Tagged ORF Clone

Sign In for Pricing
View Details
HSPA5 Monoclonal Antibody
E-AB-22167-01 20 µL

HSPA5 Monoclonal Antibody

Sign In for Pricing
View Details
HSPA5 Monoclonal Antibody
E-AB-22167-02 60 µL

HSPA5 Monoclonal Antibody

Sign In for Pricing
View Details
HSPA5 Monoclonal Antibody
E-AB-22167-03 120 µL

HSPA5 Monoclonal Antibody

Sign In for Pricing
View Details
HSPA5 Monoclonal Antibody
E-AB-22167-04 200 µL

HSPA5 Monoclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ α-Glucosidase Assay Kit
DAGD-100 100 Tests

QuantiChrom™ α-Glucosidase Assay Kit

Sign In for Pricing
View Details