Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Peptide - middle region

HSPB11 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf41, HSPCO34, PP25, IFT25

UniProt

Q9Y547

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB11 Rabbit Polyclonal Antibody (orb326616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057210

Preservative

Lyophilized powder

AA Sequence

IERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-(1,6-Hexanediyl)bis[5-benzofurancarboximidamide]
TRC-H416190-50MG 50 mg

2,2'-(1,6-Hexanediyl)bis[5-benzofurancarboximidamide]

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS702102 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
ZFYVE27 Rabbit Polyclonal Antibody
TA370573 100 µL

ZFYVE27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(S)-2,6-Diamino-N-((S)-1-oxo-1-phenylpropan-2-yl)hexanamide Dihydrochloride
TRC-D933410-25MG 25 mg

(S)-2,6-Diamino-N-((S)-1-oxo-1-phenylpropan-2-yl)hexanamide Dihydrochloride

Sign In for Pricing
View Details
Recombinant Mouse RANKL/TNFSF11 Protein (His Tag)
PKSM041165-01 10 µg

Recombinant Mouse RANKL/TNFSF11 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse RANKL/TNFSF11 Protein (His Tag)
PKSM041165-02 50 µg

Recombinant Mouse RANKL/TNFSF11 Protein (His Tag)

Sign In for Pricing
View Details