Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS16 Peptide - C-terminal region

MRPS16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-132, COXPD2, FLJ22062, FLJ40972, MRP-S16, RPMS16

UniProt

Q9Y3D3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS16 Rabbit Polyclonal Antibody (orb586628) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057149

Preservative

Lyophilized powder

AA Sequence

EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SVL3 Antibody
orb851748 2 mg

SVL3 Antibody

Sign In for Pricing
View Details
PSMD9 (NM_002813) Human Recombinant Protein
TP300903M 100 µg

PSMD9 (NM_002813) Human Recombinant Protein

Sign In for Pricing
View Details
Compound Fr12158
Fr12158-01 500 mg

Compound Fr12158

Sign In for Pricing
View Details
Compound Fr12158
Fr12158-02 2 g

Compound Fr12158

Sign In for Pricing
View Details
Rotavirus, Strains RRV, WA (APC) discontinued
138301-APC 100 µL

Rotavirus, Strains RRV, WA (APC) discontinued

Sign In for Pricing
View Details
5- (5- ((4-Cyclopentylpiperazin-1-yl) sulfonyl) -2-ethoxyphenyl) -1-methyl-3-propyl-1H-pyrazolo[4,3-d]pyrimidin-7 (6H) -one
161742 25 mg

5- (5- ((4-Cyclopentylpiperazin-1-yl) sulfonyl) -2-ethoxyphenyl) -1-methyl-3-propyl-1H-pyrazolo[4,3-d]pyrimidin-7 (6H) -one

Sign In for Pricing
View Details